@ P   @2p  @@@ .textp p  p .init@ @ 0@ .finip p 0p .data@@@ @.xdata@@@@3@ @.pdata  5.rdata@ @ z@.rconst   .lita  q.sdata;@;@ .sbss=@=@ .bssB@B@@0.commentt@(#)$RCSfile: crt0.s,v $ $Revision: 1.1.26.2 $ (DEC) $Date: 1997/04/03 22:25:40 $, file NNNNNAssertion failed: , line NNNNN libc.cat (0@@P` @@@   (_%*.*f%*.*f%*.*f%*.*f%*.*%*.%*%f*f.*f*.*f  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@(#)$RCSfile: f64_stat.s,v $ $Revision: 1.1.2.3 $ (DEC) $Date: 1999/02/18 18:26:22 $@(#)$RCSfile: f64_lstat.s,v $ $Revision: 1.1.2.3 $ (DEC) $Date: 1999/02/18 18:26:22 $@(#)$RCSfile: strncpy.s,v $ $Revision: 1.1.4.1 $ (DEC) $Date: 2000/04/20 17:52:49 $ GMTmn8 > ףJ$I$I ijJrE.“$I //etc/zoneinfolocaltimeposixrulesTZResolver Error 0 (no error)Unknown hostHost name lookup failureUnknown server errorNo address associated with nameUnknown resolver errorResolver internal error Unknown error@pЯ: libc.cat%d.%d.%d.%dp0;Zx0Nm> ף$I%H:%M:%S%p%H:%Mppppppppppp0pppppppppppppppppppppppppppp pp;%[+-]:%u:%99[^:]:%99[^:]:%99[^:]:%n%m/%d/%yalnum``````````````````````````` ``P``````0`@0`````````````PPp` ```0%1[-+]:%u:%d/%d/%d:%63[^:]:%63[^:]:%n : Error %d occurred.libc.cat@(#)$RCSfile: f64_fstat.s,v $ $Revision: 1.1.2.3 $ (DEC) $Date: 1999/02/18 18:26:21 $@(#)$RCSfile: sigjmp.s,v $ $Revision: 1.1.4.2 $ (DEC) $Date: 1994/04/05 22:25:59 $@(#)$RCSfile: setjmp_incl.s,v $ $Revision: 1.1.4.5 $ (DEC) $Date: 1994/05/13 18:07:02 $tis TEBGlobal lockDECthreads InternalTIS mutex %dTIS cond %d ᯼ ᯼ .textNLSPATH؉$@ C%dF0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0FpC0F0FE0F0F0F0F0F0F@D0F0F0F0F0FC0F0F ECAT_DEBUGCAT_MIDFMT_CAT_MIDFMTCAT_MIDSETCAT_MIDSET_%/usr/lib/nls/msg/%L/%Niconv_closeiconviconv_open/usr/shlib/libiconv.so/usr/share/.msg_conv-classseverityLANG$@ Error %d occurred.libc.catJ$I$IINFNaNSNaNQ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit.SunMonTueWedThuFriSatSundayMondayTuesdayFridayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryMarchAprilMayJuneJulyAugustOctoberAMPM^[yY].*^[nN].*yes:y:Yno:n:N.AMPMSunMonTueWedThuFriSatSundayMondayTuesdayFridayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryMarchAprilMayJuneJulyAugustOctober.yes:y:Yno:n:N^[nN].*^[yY].*ISO8859-1%m/%d/%y%H:%M:%S%a %b %e %H:%M:%S %Y%I:%M:%S %pWednesdayThursdaySaturdayFebruarySeptemberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y%H:%M:%SWednesdayThursdaySaturdayFebruarySeptemberNovemberDecemberISO8859-1%I:%M:%S %p00010203040506070809101112131415161718192021222324252627282930313233343536373839404142434445464748495051525354555657585960616263646566676869707172737475767778798081828384858687888990919293949596979899 ףp= ף@@`@` ` ```````````P``````````````@   `````P``P```@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@(null)0123456789ABCDEF0123456789abcdef0X0x+ -p@000p@@p@000p@@              p                @          00   0p  @  @ P0pppSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec> ףINFNANINITY%1$@LKKKKJJK K@K`KKKpJJ0JJ0JJJJJJJJJJJJpJJJJJIJJ`IJJJJJJJ`JI0J0J0JJIJJJJII JJJ`JJIJJI@<@<`<`<`<`<@<`<`<@<)*)****************6***********`6)))*6*****p66****`6**6# ?# ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?# ? ?# ? ? ? ? ? ? ?##### ?# ? ? ? ? ?## ? ?# ?# ? ?#@(#)$RCSfile: Tgettimeofdy.s,v $ $Revision: 1.1.2.3 $ (DEC) $Date: 1998/12/02 20:42:17 $ ::ffff:ip6.int%.*s.%.*shosts.byaddr # rhosts-%d%u.%u.%u.%u.in-addr.arpa%x.%x.ЬЬЬpphosts.bynameyellowup: getdomainname system call missing libc.soSuccessfulNot ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesResource deadlock avoidedNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleItem is not local to hostRPC structure is badRPC version is wrongRPC program not availableProgram version wrongBad procedure for programNo locks availableFunction not implementedError number 79 occurredNo message of desired typeIdentifier removedOut of STREAMS resourcesSystem call timed outNext message has wrong typeError in protocolNo message on stream head read qfd not associated with a streamTells open to clone the deviceMounting a dirty fs w/o forceDuplicate package nameVersion mismatchUnresolved package nameUnresolved symbol nameOperation canceledCannot start operationInappropriate operation for file typeOperation in progressToo many timersFunction not implementedInternal AIO operation completeReserved.Reserved.Value too large to be stored in data type.Error 104 occurred.Error 105 occurred.Error 106 occurred.Error 107 occurred.Error 108 occurred.Error 109 occurred.Error 110 occurred.Error 111 occurred.Error 112 occurred.Error 113 occurred.Error 114 occurred.Error 115 occurred.Illegal byte sequence@(#)$RCSfile: _longjmp.s,v $ $Revision: 1.1.6.2 $ (DEC) $Date: 1994/11/23 19:18:47 $@(#)$RCSfile: ljresume_incl.s,v $ $Revision: 1.1.4.2 $ (DEC) $Date: 1994/04/05 22:25:27 $@(#)$RCSfile: _longjmp_incl.s,v $ $Revision: 1.1.8.2 $ (DEC) $Date: 1997/04/01 19:35:56 $@(#)$RCSfile: _longjmp_internal.s,v $ $Revision: 1.1.4.3 $ (DEC) $Date: 1994/05/05 19:38:11 $@(#)$RCSfile: longjmp_incl.s,v $ $Revision: 1.1.10.2 $ (DEC) $Date: 1997/04/01 19:37:46 $@(#)$RCSfile: schyield.s,v $ $Revision: 1.1.13.4 $ (DEC) $Date: 2000/03/28 17:06:42 $ POSIXCLOCPATHLC_TIMELC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_MESSAGES/usr/lib/nls/loc/POSIXPOSIX POSIX POSIX POSIX POSIX POSIXC C C C C C @`LANGLC_ALLVUUUUUVUUUUUUU433333*VUUUUUUUJ$I$$I$I$qqqq]tE]tE]tVUUUUVUUUUUUU<;;;;%I$I$I$I$88qqP^Cy k( 0 0 aa. ]tE]t,d! B,d VUUUUUUU ףp= GzG؉ ;;;^B{ Kh/$I$ $I$I$>a{ !BB!B| ||vPuPAArqqqo0E>LϺl(k(jiAAgffffcp>baaaB_~A_}F]t]tE]t\[lllBB,d brcr1\VUUUUVUUUUUUU)x9Sr ^NQGzGBAAAAAAAON;;;>S!5Lh/Kh/yJ)A)J$I$I$I$Hp}~GpFXia{JݗVFpREDDDD7S\2 B!B!BBAAA@? > ||~5&rv 1̵ak;:AAt 9h98qq9p8p8"uLϺ6i贁N6P^k(M S;5H4HAAґ=ӑ=QȞ43333ޚ)Sn18!8:ˊ1 0 aa/ ~A_}/IyLȤx.]tE]tq \.p.؂-lll.-hhhe! YB,d ,X`X`cr1cr1\,Fڱ1Ҏ#XVUUUUUUU`\Q/~QSr ^NX +jJ(\GzG\ ߈実-VoDBAAAAAAAE|'J">(vb'v;;;(p'p888peCjS!5cEi|do 4>2&^Kh/&i?YNش,<%S)A)%jNPs 5'%I$I$I$I$@$C"x!$>~GpQ9(jP#,4a{$0#0c+FpR&&]\\#""""|iV). M!h h C!B!B6^I w/$! AAA @   YF'YF| ||0{0{ rv s:Ws?n]qh?n]kakKe{9ÂKe{AAAX.CX:h9hU0KU0Kqqq@?8p8pAҽto@ҽLϺLϺַ8ַN贁Nd dk(k(XWXWW;mЦЦmЦAAA?m?mQȞӑ=QȞK-J-̀O'ˀOoSnZ"000ˊ8:ˊ _nL _naaa,wɃ+wɃ_@_@}~A_} zF5 zȤxyLȤxKC}vJC}vE]t]tE]tnBr]mBr.p.p4vnl|3vnlllll8j?)7jhhhhhf/f,dB,dp?bx#p?bX`X`X`u^u^u^2\cr1\VZlVZ#X1Ҏ#XW#WVUUUUVUUUUUUUASp@S0~QQ/~QPPPPPr ^NSr ^N[rLPZrL,jJ+jJ.;SIn-;SIzGGzG] F\ F.VoD実-VoDR]bBnQ]bBBAAAABAAAAAAA???K">'J">GZ<AtGZ<;;;;;‘9r3‘988888=ߘ6Tyt=ߘ6!5S!5|E3 {E34>2o 4>201 0Kh/Kh/\.p \.ش,Nش,J@+J@+B))A)((((( 5'Ps 5' '%9/ '%$I$$I$I$gE#ͫgE# x!"x!}p v |p Gp~Gp.2D.)j(jon{a{8EG)8E(h7'hSFpRӬ]\]\\u56u5jViV Yi   Zn~ 6yYn~ h h h S :?S "BB!B`2f|`2/$w/$t}GA@s}AAAQ Q !@    PI IeLW 1S,#'YF!/P0Bd_> || -?NX =`0{It_rv ,ՠmFuYAIHֹ:Ws΋3 .qh?n]PI͵sakD1"/ ¥9ÂKe{׉׬d +W AAԉe9?r w{e.CXЉ&raK& H9h͉lm` *%U0K2Y eIʏ8qqk \Mʼn x? vɩ5lSk8p8p5th>X ¡L\to@ҽB,'XOgLϺIXq5Q a8ַɻ/2R;.^A t贁NIVB"lt e dɶʎYJ>*5k(ICII,ր+XWW @|xʿ~ɰT{;ɯ2\e.6 hЦmЦE;WvtI AAI)>TaQ|¢I˟?m   tdӑ=QȞ \ӂvy &wJ-ɤR'q QNɣɢwlx)>Rɡf''ˀOɠ_+z7˕ɟESnɞ3`βgLɝNZ" xjO  Ԑ |  ד2qs'e i 00It/I`{e8:ˊI `^/7L _n=+ {B 0 aaɓxJC}vI VV lu颋.]tE]tɆ*T Os 7C!]mBrIlÛuن7q].pɃ'o&o&o Zl|3vnI41hbm ` lllɀUHϣ1k ?)7jIG9. si~ @ hhh ~ 7q`gI}Rc/f|)|3S$e |ZBB,dI{Wĵ k5cz x#p?b zA:6KaIy ,X`X`xJ!ߒBCf_ x:u^u^Iwh>îJS*>|]v\ALcr1\ v@2խ d̫[u X+`lVZtw<YIt v1Ҏ#Xs YV`X si#WIrӽ.ŧ{9VqVUUUUUUUIq5/9/k^rTpGJȩp@S pAWTjRoW?Q/~QnyVL.PIn PPPm{E-8OImy9/Sr ^Nl¦;M l.9UPZrLk5ChK k~+jJjk`'J jϩn-;SIi )@# RHhq= ףGzGIh̢qnQbEFg?^\ FIg<Ϟlw,=Ef+7実-VoDIf`9ѡ sCe.1knQ]bBIe2>eR BdBAAAAAAAIdt<e`V-x@c ؟??Ic.ztmZ*>b&e'J">IbT̮[\]= b#LAtGZ2I[PǺØ`u1Z h1 0IZ!VA&@0 Z %Kh/YuZ_. Y].p \.Xk P. P-IX lONش,Wrq+W h%J@+ WHS:0yE>Hz>ư>h㈵>-C6?MbP?{Gz???$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDJ-DyCxD(,* E52TEqىE/'E!1Eꌠ9Y>)F$_FnFF"F|FMraB3G yhGiWCG*GJH\)c=H7]rHaxHyֲHL}YI\CkFI3T|I\'I^ 9^;j7֖6P:2 ǼH.D|)޷ET%u?j/ ȮSd>?- }+) MB~O{ \Hz\/u5%P7xf @,1BBB d d d hhkkkL!L!L!-$-$-$.&.&O&p&MDyֲHrbnMz5߼Qҟ&V;/V[EW`VfYdsTNNe VBij㒻Tmz42q/Ngvۗ:5P{3t<{aaa"" fff'ii    ###n& d'@Bʚ; TvHrN @zZƤ~o#]xEcd #NJ;5H~t۝Xv%QӮS;uD'm,{tPd弥a}J]I62w[Mľ٬:|\ 5$KB.̈Po ̼$ 믿ۗ6A_paw̫BzՔֶil7#GGŧ,eX;On ףp= ף@P$ (k@C*焑 1_.@v:k #NJbxz&n2xW ?hӠ@aQYȥo: '΄ x9? 6Ngɖ"E@|op+ŝL67V߄\l: {Η H½ Pv1P?%O7и'ƫCưp\{2~]o0b/5E=!dhknrux| "%(,/269<@CFJMPTWZ^adgknqux{QӮeMq3Ag˻zNdP#vڍMS T]"%oDzw,n% DHZ;SC.>Bs    " " " "    GGG((( *$*$*$*$K'K'K'***---n1n1n1n1: 'fPKS^=ߕ^Tjᕝ_vIξTSܷ dp폔ܔs}cO 5v)/@i``````` # # # %%%HHH!!!!*%*% ( ( ( (,+\mʥJ '522q#2IkXWڥ%I-64OSá#-ޟݦP)r}XPT\eƑP(= e uuvRΚ2(M]=];JJ?Lɚ R`ķn%4~4Ud^wH~t*J6ڝXv%"݃:QӮC5yrjR;uD<u'm8c$S,^{tPd2l1+a}JϟCb.2:]Ç I62wyh.L[Mľ K7٬:|S\ 5$oe(KB.E.D?ˈPo ̼I9i$ MZDs10 h16A_p=|6+ aw̫Miv2=BzՔI?il7Tr3܀#GGŧN@a+eX&1Zd;Onp= ףp= ףp= ף̨f0K=eMq3pj:U&N5 ʕ%ΟkSkuzcZ CV@@11f%H;ԭ¿4=I(S(96'f@Ob˻_tF cccccccD"D"D"D"D"D"D"((((((f/f/f/f/f/f/f/'5'5'5'5'5'5;;;;;;BBBBBBBmAePKԟYFK4>QUX H{%;#K ж%YJ^MDb;uj= bڸ#MPu8벚ƣJy©?7rbcΔ'j:b.hԽBxDuBpV4ꍛs cccccccd"d"d"d"d"e'e'e'e'e'e'e'&.&.&.&.&.&.&.'5'5'5'5'5'5;;;;;;;B00000000b,c,c,c,c,c,c,c,c,c,cbbbb,cbbbbbbbbbb\Failure to initialize session ERRORlibc.catFailure to release session EVENTFailure to release session ERRORlibc.cat/bin/shtty/audgen(LOGIN): %m::Invalid accountFailed authenticationLogin succeededargv[0]=\argv[0]=argv=(unknown)(nil)seek failed for %s, error %s. Can't open %sERRORlibc.cat/var/adm/lastlogLogging in with home = "/".No directory!seteuid: %serror setting terminal mode: %s. terminal/dev/??/dev/ttyinitgroups: %ssetgid: %ssetlogin: %sFailure to launch sessionSuccessful launching of sessionEVENTcannot audit %lu login, error %s ROOT login on %sDIALUP: %s %sttyd/sbin/loaderThe shared library loader cannot be activated for this processunable to malloc bsd_mech structERRORFailure to allocate entityERRORlibc.catinitgroups: %s is in too many groups libc.catlogin: nobodynologinno usenobody/tmp/bin/falsePassword:libc.cat/var/adm/wtmp%lu%ld@ P p        %u%d0    @    P  libc.so:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'(08@ '/7?&.6>%- 5=$, 4<#+ 3;"* 2:!) 1991)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                     %s %d SIA collect timed out. SIA collect aborted. Response must contain only printable characters.Response must contain only alphanumeric characters.Response must contain only numbers.Response must contain only letters.Response must contain at least %d characters. libc.catResponse too long. r+/dev/tty %s (nothing) You have selected: You have selected %d items: You have selected 1 item: Please select exactly ONE item %.*s ** Invalid choice(s): %.*s ** Invalid choice: %.*s Select item by number [Example: 1]: Select items by number [Example: 1 %d]: Select ONE item by number: ] [Default selection: %4d %s allocaresult is a NULL pointer, i=%d min result length not less than max result length, i=%d control flags out of bounds prompt is a NULL pointer, i=%d num_prompts out of bounds rendition out of bounds timeout too small )x9/bsdNPPSLK P     p libc.catno message available %lu:group.bynamer/etc/grouppasswd.byuidpasswd.bynamegroup.bygid%u%d @(#)$RCSfile: __oflock.s,v $ $Revision: 1.1.2.3 $ (DEC) $Date: 1997/07/10 14:57:52 $yp_all - RPC clnt_call (TCP) failureyp_all - TCP channel create failure%s.%s@%s%s.%d@%s @ p clnttcp_create: out of memory - %s RPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Unknown protocolRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)Authentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)RPC: (unknown error code)Error %d%s: ; s1 = %lu, s2 = %lu(unknown authentication error - %d)%s; why = ; low version = %lu, high version = %lu; errno = %s0 0 0 0  ` 0 0 0 0 0 0 0 0 0 xdrrec_create: out of memoryxdr_reference: out of memoryUnable to convert `%s' to a bind address. Reverting to ANY. connection_host_name == NULLconnect.cconnection_host_name != NULLConnecting to %s[%s]:%hu... Connecting to %s:%hu... Closing fd %d connected. Created socket %d. failed: %s. Master socket fd %d bound. using port %i. .ACreated socket fd %d. Apparently %s has been removed. Scanning %s (from %s) will convert url %s to local %s will convert url %s to complete Converted %d files in %.2f seconds. @@Converting %s... nothing to do. Cannot convert links in %s: %s Unable to delete `%s': %s wbSomething strange is going on. Please investigate.Skipping %s at position %d. TO_RELATIVE: %s to %s at position %d in %s. TO_COMPLETE: to %s at position %d in %s. %d-%d *s1 != '/'convert.cCannot back up %s as %s: %s %d; URL=%sto - newname == fsqlen/index.htmlfile != NULLDeleted old cookie (to be replaced.) (ANY)nonpermanentpermanent Stored cookie %s %d%s %s %s %d %s %s %s res != 0cookies.cDiscarded old cookie. name_b != NULL && name_e != NULLdomainpathexpiresmax-age%lfsecureError in Set-Cookie, field `%s'Syntax error in Set-Cookie: %s at position %d. _4`` axaaa,bbb.com.edu.net.org.gov.mil.intcdm: 1 2 3 4 5 6 7 8Cookie coming from %s attempted to set domain to %s Attempt to fake the path: %s, %s ocnt == countCookie: pos == result_sizerCannot open cookies file `%s': %s TRUE?FALSE:%d %s %s %s %.0f %s %s Saving cookies to %s. w# HTTP cookie file. # Generated by Wget on %s. # Edit at your own risk. Error writing to `%s': %s Error closing `%s': %s Done saving cookies. bytecon != NULLftp.ccon->target != NULL!((cmd & DO_LIST) && (cmd & DO_RETR))(cmd & (DO_LIST | DO_CWD | DO_RETR | DO_LOGIN)) != 0user && passwd%s@%sLogging in as %s ... Error in server response, closing control connection. Closing fd %d Error in server greeting. Write failed, closing control connection. The server refuses login. Login incorrect. Logged in! ==> SYST ... Server error, can't determine system type. done. ==> PWD ... /Initial VMS directory not in the form [...]! Preprocessing the initial VMS directory old = '%s' new = '%s' done. ==> TYPE %c ... Unknown type `%c', closing control connection. done. ==> CWD not needed. changing working directory Prepended initial PWD to relative path: pwd: '%s' old: '%s' new: '%s' *ntarget == '/'Changed file name to VMS syntax: Unix: '%s' VMS: '%s' ==> CWD %s ... No such directory `%s'. ==> CWD not required. ==> SIZE %s ... ==> PASV ... Cannot initiate PASV transfer. Cannot parse PASV response. couldn't connect to %s:%hu: %s ==> PORT ... socket: %s Bind error (%s). Invalid PORT. ==> REST %ld ... REST failed; will not truncate `%s'. REST failed, starting from scratch. ==> RETR %s ... No such file `%s'. ==> LIST ... No such file or directory `%s'. .Lying FTP server found, adjusting. accept: %s wbab%s: %s Length: %s [%s to go] (unauthoritative) %s: %s, closing control connection. %s (%s) - Data connection: %s; %s (%s) - Control connection closed. Data transfer aborted. r%s TĄ\ԃLP|@ȓTTTTTTTTT\TT(TTT\TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTFile `%s' already there, not retrieving. (try:%2d)--%s-- %s %s => `%s' %s (%s) - `%s' saved [%ld] %s URL: %s [%ld] -> "%s" [%d] Removing file due to --delete-after in ftp_loop_internal(): Removing %s. unlink: %s \xx\xxxx\xx\xxxd\\x\\x.listingUsing `%s' as listing tmp file. Removed `%s'. Recursion depth %d exceeded max. depth %d. f != NULLRemote file no newer than local file `%s' -- not retrieving. Remote file is newer than local file `%s' -- retrieving. The sizes do not match (local %ld) -- retrieving. Invalid name of the symlink, skipping. Already have correct symlink %s -> %s Creating symlink %s -> %s symlink: %s Skipping directory `%s'. %s: unknown/unsupported file type. %s: corrupt time-stamp. Unrecognized permissions for %s. Will not retrieve dirs since depth is %d (max %d). %s%s%s/%sComposing new CWD relative to the initial directory. odir = '%s' f->name = '%s' newdir = '%s' Not descending to `%s' as it is excluded/not-included. ../Rejecting `%s'. No matches on pattern `%s'. Wrote HTML-ized index to `%s' [%ld]. Wrote HTML-ized index to `%s'. %s %s%s%s PASS--> %s --> PASS Turtle Power! --> %s 331 s/key 331 opiekey USER%d,%d,%d,%d,%d,%dPORTPASVTYPECWDRESTRETRLISTSYSTVMSUNIXWINDOWS_NTMACOSOS/400PWD"SIZEtype=JanFebMarAprMayJunJulAugSepOctNovDecrb%s: %s total PLAINFILE; DIRECTORY; SYMLINK; UNKNOWN; implicit perms %0o; perms %0o; month: %s; day: %d; year: %d (no tm); time: %02d:%02d:%02d (no yr); -> link to: %s ... Ignoring `.' and `..'; trailing `/' on dir. trailing `@' on link. trailing `*' on exec. Skipping. -Name: '%s' :MYYYY/MM/DD HH:MM - %d/%02d/%02d %02d:%02d Timestamp: %ld Directory File, size %ld bytes wrong VMS permissons! JANFEBMARAPRMAYJUNJULAUGSEPOCTNOVDECfile name: '%s' .DIRFile Getting additional line empty line read, leaving listing parser confusing VMS listing item, leaving listing parser second token: '%s' day: '%s' nonsense in VMS listing, skipping this line date parsed YYYY/MM/DD HH:MM:SS - %d/%02d/%02d %02d:%02d:%02d ,)confusing VMS permissions, skipping line permissions: %s -> 0%o Unsupported listing type, trying Unix listing parser. wb%s%s%s@ �Index of /%s on %s:%d� 

  %d %s %02d %02d:%02d         time unknown       File        Directory   Link        Not sure    %s  (%s bytes)(nil)-> %s
store is `%s' POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument );Ok[WQ /?!"i,9Ka~j e7 CA f!*7H}P^zKd5U_ %/^k=OG[)6FI\( QK55>n)#5Fu[~Tv>ԙwQ???%s index >= al->faulty && index < al->counthost.cindex == al->faultycount > 0Releasing %p (new refcount %d). Deleting unused %p. Caching %s => %s Found %s in host_name_addresses_map (%p) Resolving %s... failed: %s. failed: timed out. %s, , ...u->host != NULLUnknown errorHost not foundal->refcount == 1ltgtampquotnbspto - (pool->contents + pool->tail) <= end - beghtml-parse.cch == '\'' || ch == 0x22ch == quote_charch == '-'h9h999::$;D;T;;P:::\9\999\9999999999999999999\9999999999999:99999999999999999aappletareabasebgsoundbodyembedfigformframeiframeimginputlayerlinkmetaoverlayscripttabletdthhrefcodesrcbackgroundlowsrcrelhttp-equivnamecontentaction%s: no base, merge will use "%s". %s: Cannot resolve incomplete link %s. %s: link "%s" doesn't parse. %s: merge("%s", "%s") -> %s %s: merged link "%s" doesn't parse. appending "%s" to urlpos. first != -1html-url.cstylesheetshortcut iconrefreshrobotsnonenofollowt != NULL%s: %s Loaded %s (size %ld). no-follow in %s: %d %s: Invalid URL %s: %s HTTP/sock > -1 || ssl != NULLhttp.csock == -1 || ssl == NULL[writing POST file %s ... rbwritten == promised_sizedone] bytesnoneKeep-Alivewget_cookie_jar != NULLInvalidating fd %d from further reuse. Closing fd %d pc_last_host_ip == NULLpc_last_host_ip != NULLRegistered fd %d for persistent reuse. *hs->local_file != NULLReusing connection to %s:%hu. Reusing fd %d. HEADGETPOSTReferer: %s Pragma: no-cache Range: bytes=%ld- Wget/%sAuthorizationProxy-Authorization:%dConnection: Keep-Alive Content-Type: application/x-www-form-urlencoded POST data file missing: %s Content-Length: %ld []*/*%s %s HTTP/1.0 User-Agent: %s Host: %s%s%s%s Accept: %s %s%s%s%s%s%s%s%s%s%s ---request begin--- %s[POST data: %s] ---request end--- Failed writing HTTP request: %s. HTTPProxy%s request sent, awaiting response... End of file while parsing headers. Read error (%s) in headers. No data receivedMalformed status line(no description) %2d %s%2d %sContent-LengthContent-TypeLocationLast-ModifiedSet-CookieWWW-AuthenticateAccept-RangesContent-RangeConnectioninhibit_keep_alive == 0Authorization failed. Unknown authentication scheme. Basicunspecified [following]Location: %s%s text/htmlapplication/xhtml+xml.htm.html The file is already fully retrieved; nothing to do. Continued download failed on this file, which conflicts with `-c'. Refusing to truncate existing file `%s'. Length: (%s to go)ignored [%s] wbab%s: %s Warning: wildcards not supported in HTTP. File `%s' already there, will not retrieve. (try:%2d)--%s-- %s %s => `%s' Cannot write to `%s' (%s). Unable to establish SSL connection. ERROR: Redirection (%d) without location. %s: %s ERROR %d: %s. Last-modified header missing -- time-stamps turned off. Last-modified header invalid -- time-stamp ignored. Server file no newer than local file `%s' -- not retrieving. The sizes do not match (local %ld) -- retrieving. Remote file is newer, retrieving. %d %s %s (%s) - `%s' saved [%ld/%ld] %s URL:%s [%ld/%ld] -> "%s" [%d] %s (%s) - `%s' saved [%ld] %s URL:%s [%ld] -> "%s" [%d] %s (%s) - Connection closed at byte %ld. %s (%s) - `%s' saved [%ld/%ld]) %s (%s) - Connection closed at byte %ld/%ld. %s (%s) - Read error at byte %ld (%s).%s (%s) - Read error at byte %ld/%ld (%s). ԊԊt؋0000000Ԋ0000000000000  00ԊԊ0000008Ԋ000Ԋ00000Ԋ00%a, %d %b %Y %T%A, %d-%b-%y %T%a, %d-%b-%Y %T%a %b %d %T %Y%s:%s%s: Basic %s 0123456789abcdefrealmopaquenonce:Authorization: Digest username="%s", realm="%s", nonce="%s", uri="%s", response="%s", opaque="" DigestNTLMacceptaddhostdiralwaysrestbackgroundbackupconvertedbackupsbasebindaddresscacheconnecttimeoutcontinueconvertlinkscookiescutdirsdebugdeleteafterdirprefixdirstructdnscachednstimeoutdomainsdotbytesdotsinlinedotspacingdotstyleexcludedirectoriesexcludedomainsfollowftpfollowtagsforcehtmlftpproxyglobheaderhtmlextensionhtmlifyhttpkeepalivehttppasswdhttpproxyhttpsproxyhttpuserignorelengthignoretagsincludedirectoriesinputkilllongerlimitrateloadcookieslogfileloginmirrornetrcnoclobbernoparentnoproxynumtriesoutputdocumentpagerequisitespassiveftppasswdpostdatapostfileprogressproxypasswdproxyuserquietquotarandomwaitreadtimeoutreclevelrecursiverefererrejectrelativeonlyremovelistingrestrictfilenamesretrsymlinksretryconnrefusedrobotssavecookiessaveheadersserverresponsespanhostsspiderstrictcommentstimeouttimestampingtriesuseproxyuseragentverbosewaitwaitretryanonymous-wget@no_proxy @HOMEWGETRC%s: WGETRC points to %s, which doesn't exist. %s/.wgetrcrb%s: Cannot read %s (%s). %s: Error in %s at line %d. /usr/local/etc/wgetrc%s: Warning: Both system and user wgetrc point to `%s'. 0 <= comind && comind < countof (commands)init.c%s: Invalid --execute command `%s' %s: %s: Invalid boolean `%s', use `on' or `off'. alwaysnever%s: %s: Invalid boolean `%s', use always, on, off, or never. %s: %s: Invalid number `%s'. inf@0AApB?%s: %s: Invalid byte value `%s' %s: %s: Invalid time period `%s' ?N@ @@u"APppp@pppp0ppppp(ppp`%s: %s: Invalid header `%s'. %s: %s: Invalid progress type `%s'. unixwindowsnocontrol%s: %s: Invalid restriction `%s', use `unix' or `windows'. %s: %s: Invalid value `%s'. ?$@wawget-log %s received, redirecting output to `%s'. %s: %s; disabling logging. Usage: %s [OPTION]... [URL]... GNU Wget %s, a non-interactive network retriever. Mandatory arguments to long options are mandatory for short options too. Startup: -V, --version display the version of Wget and exit. -h, --help print this help. -b, --background go to background after startup. -e, --execute=COMMAND execute a `.wgetrc'-style command. Logging and input file: -o, --output-file=FILE log messages to FILE. -a, --append-output=FILE append messages to FILE. -d, --debug print debug output. -q, --quiet quiet (no output). -v, --verbose be verbose (this is the default). -nv, --non-verbose turn off verboseness, without being quiet. -i, --input-file=FILE download URLs found in FILE. -F, --force-html treat input file as HTML. -B, --base=URL prepends URL to relative links in -F -i file. Download: -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). --retry-connrefused retry even if connection is refused. -O --output-document=FILE write documents to FILE. -nc, --no-clobber don't clobber existing files or use .# suffixes. -c, --continue resume getting a partially-downloaded file. --progress=TYPE select progress gauge type. -N, --timestamping don't re-retrieve files unless newer than local. -S, --server-response print server response. --spider don't download anything. -T, --timeout=SECONDS set all timeout values to SECONDS. --dns-timeout=SECS set the DNS lookup timeout to SECS. --connect-timeout=SECS set the connect timeout to SECS. --read-timeout=SECS set the read timeout to SECS. -w, --wait=SECONDS wait SECONDS between retrievals. --waitretry=SECONDS wait 1...SECONDS between retries of a retrieval. --random-wait wait from 0...2*WAIT secs between retrievals. -Y, --proxy=on/off turn proxy on or off. -Q, --quota=NUMBER set retrieval quota to NUMBER. --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. --limit-rate=RATE limit download rate to RATE. --dns-cache=off disable caching DNS lookups. --restrict-file-names=OS restrict chars in file names to ones OS allows. Directories: -nd, --no-directories don't create directories. -x, --force-directories force creation of directories. -nH, --no-host-directories don't create host directories. -P, --directory-prefix=PREFIX save files to PREFIX/... --cut-dirs=NUMBER ignore NUMBER remote directory components. HTTP options: --http-user=USER set http user to USER. --http-passwd=PASS set http password to PASS. -C, --cache=on/off (dis)allow server-cached data (normally allowed). -E, --html-extension save all text/html documents with .html extension. --ignore-length ignore `Content-Length' header field. --header=STRING insert STRING among the headers. --proxy-user=USER set USER as proxy username. --proxy-passwd=PASS set PASS as proxy password. --referer=URL include `Referer: URL' header in HTTP request. -s, --save-headers save the HTTP headers to file. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --cookies=off don't use cookies. --load-cookies=FILE load cookies from FILE before session. --save-cookies=FILE save cookies to FILE after session. --post-data=STRING use the POST method; send STRING as the data. --post-file=FILE use the POST method; send contents of FILE. FTP options: -nr, --dont-remove-listing don't remove `.listing' files. -g, --glob=on/off turn file name globbing on or off. --passive-ftp use the "passive" transfer mode. --retr-symlinks when recursing, get linked-to files (not dirs). Recursive retrieval: -r, --recursive recursive download. -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). --delete-after delete files locally after downloading them. -k, --convert-links convert non-relative links to relative. -K, --backup-converted before converting file X, back up as X.orig. -m, --mirror shortcut option equivalent to -r -N -l inf -nr. -p, --page-requisites get all images, etc. needed to display HTML page. --strict-comments turn on strict (SGML) handling of HTML comments. Recursive accept/reject: -A, --accept=LIST comma-separated list of accepted extensions. -R, --reject=LIST comma-separated list of rejected extensions. -D, --domains=LIST comma-separated list of accepted domains. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. -G, --ignore-tags=LIST comma-separated list of ignored HTML tags. -H, --span-hosts go to foreign hosts when recursive. -L, --relative follow relative links only. -I, --include-directories=LIST list of allowed directories. -X, --exclude-directories=LIST list of excluded directories. -np, --no-parent don't ascend to the parent directory. Mail bug reports and suggestions to . backgroundbackup-convertedcontinueconvert-linksdebugdelete-afterdont-remove-listingfollow-ftpforce-directoriesforce-hierforce-htmlhelphtml-extensionignore-lengthmirrorno-clobberno-directoriesno-host-directoriesno-host-lookupno-http-keep-aliveno-parentnon-verbosepassive-ftppage-requisitesquietrandom-waitrecursiverelativeretr-symlinksretry-connrefusedsave-headersserver-responsespan-hostsspiderstrict-commentstimestampingverboseversionacceptappend-outputbackupsbasebind-addresscacheconnect-timeoutcookiescut-dirsdns-timeoutdirectory-prefixdns-cachedomainsdot-styleexecuteexclude-directoriesexclude-domainsfollow-tagsglobheaderhtmlifyhttp-passwdhttp-userignore-tagsinclude-directoriesinput-filelevellimit-rateload-cookiesnooutput-documentoutput-filepost-datapost-fileprogressproxyproxy-passwdproxy-userquotaread-timeoutrejectrestrict-file-namessave-cookiestimeouttriesuser-agentrefereruse-proxywaitwaitretrynoparentdeleteafterretrsymlinksignorelengthpassiveftpnoclobberfollowftpcutdirsdirstructaddhostdirremovelistingbindaddresshttpkeepaliveoffrandomwaithtmlextensionforcehtmlspanhostsbackupconvertedconvertlinksrelativeonlypagerequisitesserverresponsesaveheadersGNU Wget %s %sCopyright (C) 2003 Free Software Foundation, Inc. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. Originally written by Hrvoje Niksic .retryconnrefusedstrictcommentsonhttpuserhttppasswddotstyleexcludedomainsproxyuserproxypasswdfollowtagsloadcookiessavecookieslimitratepostdatapostfilednscacherestrictfilenamesdnstimeoutreadtimeoutconnecttimeoutlogfileignoretagsincludedirectoriesinputreclevel%s: illegal option -- `-n%c' Try `%s --help' for more options. outputdocumentdirprefixuseragentexcludedirectoriesuseproxyhpVqvdkKsxmNWrHSLcFbEY:G:g:T:U:O:l:n:i:o:a:t:D:A:R:P:B:e:Q:X:I:w:C:Can't be verbose and quiet at the same time.Can't timestamp and not clobber old files at the same time.%s: missing URL DEBUG output created by Wget %s on %s. osf5.1wbabRemoving file due to --delete-after in main(): Removing %s. unlink: %s No URLs found in %s. FINISHED --%s-- Downloaded: %s bytes in %d files Download quota (%s bytes) EXCEEDED! h @ P4D0P`p8D,$,<L\l|(4@P t,<L\l|,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,WTF?!SIGUSR1SIGHUP%s/%s.netrcr%s: Cannot read %s (%s). loginpasswordmacdefaccount%s: %s:%d: warning: "%s" token appears before any machine name defaultmachine%s: %s:%d: unknown token "%s" xd4dotbar %*s[ skipping %dK ] %5ldK ,dp->dots < opt.dots_in_lineprogress.c%3d%%Y@ %s. defaultbinarymegagigaInvalid dot style specification `%s'; leaving unchanged. i@b@B/sK/sM/sG/spercentage <= 100%2d%% dlsz <= progress_sizeinsz <= dlsz %-11s %7.2f%s --.--K/s ETA %02d:%02d ETA %d:%02d:%02d p - bp->buffer <= bp->widthY@p@ @@@|jYH TERMforceemacsEnqueuing %s at depth %d Queue count %d, maxcount %d. Dequeuing %s at depth %d %s: %s. Already downloaded "%s", reusing it from "%s". Not descending further; at depth %d, max. %d. url_parsed != NULLrecur.crecursive rejection criteria--delete-afterRemoving file due to %s in recursive_retrieve(): Removing %s since it should be rejected. Removing %s. unlink: %s Deciding whether to enqueue "%s". Already on the black list. Not following non-HTTP schemes. It doesn't really look like a relative link. The domain was not accepted. Going to "%s" would escape "%s" with no_parent on. %s (%s) is excluded/not-included. %s (%s) does not match acc/rej rules. This is not the same hostname as the parent's (%s and %s). Not following %s because robots.txt forbids it. Decided to load it. Decided NOT to load it. orig_parsed != NULLnew_parsed != NULLRedirection "%s" failed the test. wgetj == cntres.c!EOL (p)Ignoring malformed line %duser-agentallowdisallowIgnoring unknown field at line %dCannot open %s: %sRejectingAllowing%s path %s because of rule `%s'. /robots.txtLoading robots.txt; please ignore errors. deferring a %.2f ms sleep (%ld/%.2f). sleeping %.2f ms for %ld bytes, adjust %.2f ms @@i@B/sKB/sMB/sGB/s%.2f %s%7.2f %smsecs >= 0retr.cbytes >= 0@@@0AP?A>>%s: %s. Error parsing proxy URL %s: %s. Error in proxy URL %s: Must be HTTP. mynewloc != NULL%d redirections exceeded. Removing file due to --delete-after in retrieve_from_file(): Removing %s. unlink: %s Retrying. Giving up. sleep_between_retrievals: avg=%f,sleep=%f .A%s.%dhttp_proxyftp_proxyCBBBBQ00000000000000000000000000000000  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~http://ftp://0123456789ABCDEFp2 - newstr == newlenurl.c@/?#;ftp://%shttp://%sNo errorUnsupported schemeEmpty hostBad port numberInvalid user nameUnterminated IPv6 numeric addressIPv6 addresses not supportedInvalid IPv6 numeric address:/;?#/;?#;?#?#*p == 0error_code >= 0 && error_code < countof (parse_errors)Removing %s because of directory danger! %s: %sq - TAIL (dest) == outlenindex.html?;#scheme_str != NULL*password*p - result == size%s: %s: Not enough memory. mallocreallocstrdup%02d:%02d:%02d%04d-%02d-%02d %02d:%02d:%02dwget-logforkContinuing in background, pid %d. Output will be written to `%s'. /dev/nullrwutime(%s): %s Unlinking %s (symlink). Failed to unlink symlink `%s': %s rbhtmlhtm1%ldgfffffffgfffffff ףp= ףS㥛 KY8m4 k)4ׂCBzՔ0ˆ;U T& .vHW:o$ rN 3"[3/#?zZЄK8Ƥ~͕PMB @zZo#mVX{HƤ~]xEcWx/e9o#c %ZR;\]xEcC]rd @@?l,,?@@.AeAsig == SIGALRMutils.c.A1.9O & " " " "  " ("  0" @8" @" H" P" X" K     H pK HPO `" h" p" K x" " " " " " " " " " " O & (& 8& P& " " " " " " # # # # `& p&  # & (# 0# 8# @# H# P# X# `# h# p# x# # # & # # # # # # & # & & # # ?@# # # # # $ $  X O $ $  $ ($ 0$ 8$ @$ H$ P$ X$ `$ h$ p$ x$ `Q $ & & & $ $ $ $ $ $ $ $ $ $ $ $ ' ' $ (' $ $ % % % %  % (% 0% 8% @% H% P% 8' X% `% h% p% x% % H' % X' h' % % % % % x' % % % % % x     X   8 % ' % % % & Pg `g xg g g g g g g h h (h 8h Hh Xh hh xh h h h h h h h i i 8i Pi hi i i i i i    @ X p   Ȝ     (  P  p       8 X p   Ȟ A@A@A@A@@ A@@A@D A@=@@ di =@Ծ 8 PF B A@=@F !@  J PL L D L M Pj PM  ؿ  N R R S  PS =@S | S PU U l< =@$0 @=@ Pj d A@  = < di Pf h+ A@PM  PV V t- ] ~ > S  F  0  J 0 н p 4   d x  l x ȳ A@1 / 2 < 1 0 =@0 X  N ~  J l @Pj  ȳ @ p $ F d    0 B@p 0  di S ` &    P @  ` V A@PM p T*  @ p  ]  x <    F P @ 0     8 A@@ h  di Pf ^ ~ 0 M Pj S m o  P r dg   h xq 4d    PM Lb  i L k @@Xl   8 p V B@@Q@ p 3  T    `[ T* x  |  @ T   P   B@PV 8#  X  0 p p  &   $ `  N ` T) 0 @| t di Pj  @@   @ Pf ~ @   @   | B@$5  `  A@   V A@PM di @  Pj  J   0  S ~  @ 9 T*  > P ?   ]  > н p 3  @Pj    @  Ā  B@=@=@!@=@B =@=@B@ B@J @  !@@Q@ !@S 0    N ~ D J , p  ` 0  | t  @Pj  d  F p 0 | ~ @Pj R  S !@F B (B@A@M >@X 8 ȳ N  di  Pf    x <  | 0   p F  P   ` ~ X 0B@ȳ @d  < 8B@1 `  Pj di   ( ~ 0 F    P   h+ A@PM l t- `  , @  F @Pj V C@S @  A@ d  P   ` @B@ >@>@8  >@M  (>@x  ~   di  4  `;@P      0  PM @   Pf |  @ \   T U 3  8 B@@Q@ p ]   ` 0>@ x  | )  @ T    S 0   B@ 9  V H>@@>@8>@  Ā  @ ` @ N  B ( P   | @Q@HB@ D  0  ~ V A@PM P>@T*  J    F   \. -  | p P p c@~ `>@   | 0 P h>@p>@@Q@@p x>@h >@   V  D   ! >@ A@PM /@HB@ `;@@Q@] U E  B@lJ D  J  Л p @!@ 0   k Pj V      4 p  | di PV A@PM ~  B@T x4 3 @B@p  k db n L       @>@A PB@  ~  ` J 0 V A@PM @Q@HB@    T*  P  @ >@>@S >@0 @ 4 di  Pf F   h ~ ` @Q@  N | 3   Li B J  @     0 ~ @Pj   , di   1 B@A@x  A@1  d  F  $ PV A@PM  1  h `  % & )         | 0 F ~  ` @Pj h+ A@PM di t-   4  $5 >@X l ȳ   ( Pf  x < @q@@Pj  = H< d Xq@] ,    =   <  X@ F >    , di ~   W ) ( d J   B@d ( B@p | PV A@PM  Pf  A  4  0 B  p@     0 F     `    P  N  ~ U   @Pj PV " A@PM di | $5 |  ! 4 Li HB@di D l       p@@  @@!    @ @Q@V  A@PM  Pj PV  V  `   $5   U T) ` J ` 0 ~    M PU  x ȳ x < @@  = Э   >@P Ю F ȵ@ p    p    p p @ ~ >@0@0e@l p (  S      0 @  p p p p % ~ l 0 p p p p D   P 0( p p( >@p@0e@p p p 5 3 4 Q@9 P@0e@@4 W @ 5 `  @ 0 0#   0e@?@P3 p ` O@  9  ; ;@;@ : ?@?@?@ p ?@S 0e@ x;@;@   ?@@   0# P P~  ;@p;@;@@ @r   ) a < `m o `a ?@l  `{ h v b Ч  P k k Ї  ?@ 9 ?@@4  l  P@3    н 0  5  00 Q@P@0e@~ D 0@ @ @ p  D 0  0e@?@ I ;@ ~ l 0 $  P P$  !  0 0  P  0e@@Q@Э 0 @  0#  P  ` 0  н 0e@?@ @4 0e@p 0 0e@p p p p p   p 0?@ 0# ;@ x   D  4  P @    @ @  %  l l?@T@@" @?@H?@J  B    p@0e@@4   ! 0# P$ ` * `+ $  - , P7  ;@ 0e@?@A@$ D < l 0 `) E  0 '    ~ M @@P@0e@ (B@P3  T@ O M @Q@0  p?@ @I L    ~ l 0 0 O ;@0O 0#  @  @4 0e@?@ P P7 @R W ;@ p X @ P  \  p _ d   Q S 0   0e@p@T@T p ;@;@p @X  0e@  @4     J 0 @ <@ 3 @4 3 0[  0e@@Q@ D 0  0e@@Q@?@н @Q@@ p p( P ! 0  \   \ 0  @ l  XB@hB@^  `B@ ?@]  @0e@0 p  _ p  5 0 0e@@4 5  0e@p  D   0e@?@p p p  p p  0;@@0e@_ @` p a ` a @4 pB@S A@3 0 U@1 / @ pk g @  ?@c b 3 Э b 0e@ p ?@  J 0@@B@0e@xB@~ p ?@@Q@@@ ` S P@C  @ pA @@@ @@@@@@@p@и@@0@`@@@@P@@@@@@@л@@`@@@@@@@0@p@@ l @4 m p ?@m 0@@@0e@@4    0       @ ~ l ` @ 0 > @ B @ ;@ P U   4   Ѓ  p@0 D   P l     ` л@0e@ h;@ J  u @ > ;@  ` @    ` `  P 0 ` p P л@0e@   @ U 0e@?@0C p      J 0 @ <@  ?@p1 ( p @<@0<@0( 0e@ 0e@?@p  Q@~ < 00 @ l P P@0e@p p p    @ @0e@(@` 0e@Q@ P@00 M 0e@?@     ?@"  J l ~ <@?@ ;@н @   P @) ~  l 0)       I P 0H  `S p p R ' U ;@P/ p / @4 ` @    p < PN T @4 l / ~  P ;@ x/      3 0  p 0  p `/ <@<@@<@<@@   ;@p @4 3 PU 0e@?@ @  00 Q@P@0e@@4    ` '@ ~ @    `  `M   S 3 @1 p!    `- B@@V  ;@l   ?@2 @ `J L  , . ` P < l  V 0 P PB ;  `I   p 2 0O `K p C  0 V   B@  p 0 1 @  O  A    D 0[ PL < @ > `E H F  = `  0 M @@P@0e@@L p/ '@P@0e@ @@3 Pe p @Q@`W )@@0e@l 0e@?@`l   p Q ;@R ;@J R ;@ T ;@ U p+@0+@<@P 0 @ (@l @V @4 3 l @0e@3 J *@@@~   0e@?@p S  @@ @0e@l p p `_ p S @<@0<@p S ?@0<@(@p ?@@<@p p  0e@?@p  , 0+ 0 / , 2 . + + @/ ~ < l  B ~  l  @B  0 P  <@J B @ P<@@@@@| Pz | (B 0B @ ;@;@;@;@;@;@;@;@pu < @ pn 0# U   ~ l 0 m ?@@0e@  ~ l 0 ?@m @0e@P  (@p (@p 4 Hc @c v y  z 8v Xx x u v u Pv u u 0p t Pu p t t Hs Pp Xo m Pn j l m 0@`<@0e@`  @ 0 0#   @4 @4  ;@ ;@Xc Pc     ?@ pc  `# <@<@@ ;@ ;@c  `# <@<@& ;@  ;@c p@@   `# <@<@4 ;@0 ;@ 0# ;@   ;@  @l  l p 0e@?@@ p P   0e@  @ 0e@ P  P  b Э c c P > @ '@O  m c  `m  0 P 0O P   0 c ;@V  B R  P@0e@  `   @P@@'@ 0} | {  @ @  R < `M  '@P@0e@d   ` 0 ;@@~ V B '@ ?@ 0@ p! `M    P@0e@   0 L P p@@D <@P@0e@. `   `  @  '@    <     0  O    PL P3 < ~ J   P0 / 0 @ l   p  І  b e 8 : <@<@X Э @ ~ l   p G  <@0I p І b e  D PF <@<@X   @  P= ? P d  @ PN    e e  T ~ l 0 @ U  p   l `W W l 0  l ~ ; Pg @X J @f b <@@  P  e D  PL R @e 8e  <@   0 5  L P3 i ph O e S   4 @ @ @@b  Y X p p e   @@ f m l n p W  P  @  p y ~ 1  ;  o @@  V 3   p 0  `I 0  ~ `  PB Ў @4  @0e@  @@J    P   P  @ P p+@0+@ e     @@f f Ѓ  J *@f f  @  @@@@p+@2@~ 2@0+@ l l  i `  z Hs Pp v y  z 8v Xx x u v u Pv u u @=@  | | z j 0p t Pu p t t Hs Pp n  =@Xo  @@@@0e@pk g @@) l @@| @@pj @ `f +    @p ;@p  *    ) | ~ ?@@ 0 Xo l m j 0=@n 0@` P Hs Pp v y  z 8v Xx x u v u Pv u u n @=@o @@;@l ;@p  @ P P@w pq p m pu  l P@~ 0e@R 0e@?@PF 0e@?@ + 0e@?@`+ 0e@?@+ 0e@?@p  P P @  0  `@ 0 `   0  @@  J @P    0  P3 @Q@V  <   + 0e@?@A@@@   l ~ @  P  p `  Л ~ D ȅ  , `1 / 2 P3   8 Э @ <  R@B@@@0e@b  06 0[ p: PL `0 B@p@R 8 R@ l P @ PE @@0e@D pC < p 8  @ PM P3 l  @F E P p  @ @ 0   D  4 l < ~ @@f *@ @P @0e@ @@P l l < ~  5    @  0    @  0e@ @    ` D  @ l P 4 @  ~ @ l  J P P   @ P ~ J 1   @Q@l l  h A@~  l P @ 0      @Q@J 1 @P@  D `W  l P3 @T F @Z 0Y L A@A@Ј <  G PK       L  D G 4     0  { ?@@0e@{ @0e@`  | | 0 @)   0 @ <    @@p  0 S  ] @Q@! a ` p p p p  p @   @`  ,  @ O  m P@0A@ , 2 @R@l } @A@R@  P P=@R @ L R L b PA@P3 D @4 3   PL  @P }   P @ 4  0      % b  p<    pC 0 < 0  p  5 @4 0e@5   0e@?@ 0e@?@  @F  ` *@@@~ l   l  P @  <  `=@l @0e@   @F  p *@@@l @0e@ *@@@8  D @  0[  4  ~  P3 F @Z 0Y @   P @  W   PM  < 5  @F 0    p   pg  @  Э   p P  @T [  P  i  l @0e@ Џ  @A@@?@H?@T@r@(@P3 A@@M  PU  hA@P{ v m p p p  0e@?@ p( p p 3 @4  p @@ ~ <  @0e@`  ~  P l   @F l @@l @0e@  ~  <  p p p p p  p p А `   0 @Q@   J   @ @  l  P3  @ @F |  <   P@p( `   P  Л p   D  4 $    @ 0 b `# p 0@0@   ~ <   @0e@ @ @  l   0   0 *@@@  l  P/  .  2@2@p=@P 0 @ @l  @4 3 l @0e@ J *@@@~  p p   P b  n *@@@p @4  @0e@ p P3 ~ l 0  P3   p  pA@A@ xA@ ? @Q@P  0 P3 `  @F  @ p  v u  @~   M V  ;@ @   <  0   @  P3 @ l ~ <  @0e@~ D , < l 0  - 5 p!  0 4 @ 0 J  @  0w @0e@   ) ' & % + P* ?@@    p `@  l  @F J 0@ @ P1   @ P  @  @  > D ~ 1  l  P< A@K  V 3  pG ; x  N p  z ~ @  `I p 0    PB Q @4 @; P S ; m ` @0e@j  J R pL  I @K c  p @4 0 s Pr  ?@0[  @4 0[  p  @@0e@  e  0  =@  Ђ X  p  @ `m h ~    ~ 1 ~ D   , `1 /     m b 0e@@@B@R@P3    8 Э @ <  06 @0  P `0 2 B@b  p: PL R 8 R@ l  ` ~ l 0   @ <@@  R@    @Q@    0 p  @  @  ` P P @  m   O  ~ 5  У  @ l  ~ <  l @  5\z`6p66Tz:\zP;\z;\z$<\z<\z?\z@\z`A\zD\zE\zlF\z0G\zG\z`H\z0I\z(L\z`Q\z$S\z|U\zV\zX\XTzYTzZTzD[Tz[Tz]Tz _Tz_Tz`TzpaTzaTzbTzcTzc\zc\z@d\zd\ze\z|g\zh\zDm\zq\zr\zu\z$v\zw\zx\zXy\z,z\zz\z{{TzTzЁTz4TzTz̊TzHTzTz`TzسTzTzļTztTz@TzTz4TzPTzTz\z\z\zl\zT\z\z\z\z0\zx\z\z\z\z\z\z<\z\zd\z\\z\z \z\z x Tz Tz0`LzLzLLzd Lz Lz Lz Lz@!Lz\"Lz"Lz#Lz$Lzl%Lz&Lz(LzL*Lz*LzD+L++zt>z>zP?z(GzIJyKy0Sy8UyUyXyZy[y\y\y_y`yHbydeyeygy jyXlylymymyhnynytyE0ElyEFdyeF]yhFUyFTyGTyGTyPHTyI\yIdyO@O\yO\yU\y`Y\y`\ype\y@k\yp\ys\yv\yPxx\ypyyTyzTyp{Ty~Ty`TyTy@TyTy TyTy\yQUyhMyьEy=y5y-yA%yXyюy yyxxȏxxؒxxxxؓxxxxxAxXxx}xuxؗmxtx@|xxxМx@xxx0xxПx xpxxx`xxxPx|x@|x|x|x0|x|xФ|x |xp|x|x|x`|x|x|xP|x|xxxxxx0xpx0x x@xx xx xxзx@xxx0`xxpxxx`xxx%p&x@)x)x`NxNxQxZx@[x[x\x\@]x]@^x^x^x_xbx`fx@jx kxkxkxkxlxmxmxmx@nxoxpqx sxs}xs|xsuxttxmtmxptlxulx wlxxlx{lx@lxPlxlx0lxlxlxlx@lxlxБlxlx lxPlxlxplx0lxlxplx lx`lxPlxlxаlxlxгlxlxlxplxйlxlxplxlxpPdx dxdx@lxlxlx tx0|xPtx|x|x |x|x!ux0txPtxtxPtx@tx|xxxx0xpxxPxxxxxxxPxpxxxxxxxx`xxx0xx`xxxxxxxx xxx xpy yy:,y;4y0>5y>-y>4y`?4y?A,yA4y`C4y0E4yQE-yhE%yEyEyF yFyqFxFxFxFxQGxhGxIxKx0LxNx@OxRx SxSxpVxVxWx@Zx[x\xP]xP_x` `xA`x\`xaxaxcx0cpcc ddx@qx`txtxauxpuxux0vxvxv0xxxxy`zP{|x{|x{|x@||x|x xx`xxpxxxxPxxxxxТxAxDx`x xPxxxx`xx0x`x0x`xx@xpx`xxxx0xxxpxxPxx0x`xxxMxPx`x xyxxx@x0pxxxx xxxx xxxx x0x0xxx`xxxP x xx]x`xxxx]x`xx}x|xuxtxmxlx lxexdxdxdxPdx$dx`'dx(dx`))\x)@+\x,dxd|xduxdmx!eex xG H xO x\ xP] xc xPd xd x@e xm xv x@| x} x~ x x% x( x@ x x% x( x@ x x x x x0 x0 x x xp x x x x x xp x xЍ xЏ x xБ x x0 x x xP x xp x x xЖ x` x x x x x0 x` x x x0 x  x` x x0 ` xP x x` x0 x x x xP x x x0 x xP x x x` x x x x x x x x x x x x xp x x0 x x x` x0 x x x x0 x@ x x x x xP x x x x x P x x` x  x x x` x x x x@ x x  xp x x xp x@ x x@ x x x x x x x P x x` x x x x x x0 x x! x" P" x# x`$ # 'tؽ#>"RBABRF3aB? '0}Ц '< '\ '|`@[k' ؽ# ' 'Ц '< '\ '|'e|@[k'׽# 'ئ< P}D]@#kG/kG/GG/G/'׽##^>^~ ( F 1F@F _ `=A )(s)!0@F@F@ @ U@! áu@` @ *( ?D%@ *(%@ QAn *(%@ iP@F )(s)!*(s$@_ *(%@ QAZ *(%@V )(s)!@U@"D 0@F`*(%@J @ *(F )(s)!J!@U@"D?G7@J8 D0 D@ADD@)(s !D)!*(!D. u@ @Fs-@ )EJEA_D| J!J(_*( u ?D%@ QA *(%@ )E )(B @"(s 䡵+@?@"( *(u+@S  X)(s5$@+@ADC !A)(s)!7@J8 D0 D0@FDD@'D )(sD)! ?)(s)!@(D9 @ )(sk@ cD)!@'D )(s)! ))(s)!*(s f@ e@ @?@á@ 7@J8 D0 D)(s)!@#D !A@?@*(s@  J!)(s)!! (C^>^~ (0#kG/G'ӽ##^>^p=!" x] ?"/?@'Dӽ# D "=&X1"JGfh@'ӽ#)EG]G=@'ҽ#)EG>@'ҽ#_ p=A^>^ #k'ҽ##^> F I)}}@'ҽ# ^>#k'xҽ##^> ^s^=&@-1"> !DG@'@ҽ#<_ =A $>!  ]" @ <? "$^0#k'ѽ##^> F =! &"=&1"_"Ȁ}R@'ѽ# =! &"=&1"_"Ȁ}E@'tѽ#=!^>#k'Tѽ##^>^~ F 1F RFЀ=!0> !DJE)EG<>@'ѽ##)EG>@'н# D} )E/+@'н# _AG=&1"K)EGg@'н# _AG=&1")EGg@'xн#Ѐ=?"G}n@'Xн# Di@x$C #@AD@$@>?@!  ? @>JE?&1"_"@~""}d@'Ͻ#_p=! H>!Ѐ=!)EG}G=@'Ͻ#GA>@'Ͻ#JE)ED}[@'Ͻ#JE}e@'tϽ#x=!G->@'XϽ#x=JE0> !DDpi1_JE}Q@'$Ͻ#) &"JEGg@'Ͻ#_!@G=&1"GUg@'ν#x=! &+"JEGg@'ν#ø=! )E };@'ν#G=&?1"D/:g@'lν#=!JE^>^~ `#k'<ν##^>^~ ( F 1F RF0> !D4^"Gr<@'ͽ#0>4> !A 8~!JE)EkEGm<@'ͽ#kEEE_D JE)EG<@'ͽ# 0 A4> !A? ^>^~ (P#k'\ͽ##^> F> !DG_"/@',ͽ#"!I@HA @ @CD "H#"D# 0 A)E> !DGG"@}@'̽#@^> #k'̽##^>^~ F? >(0=% e)!! )1F?"G}o@'\̽# @ =$ e! ?&1"_" > !D"}n@'̽#D "_ 2H}@'˽#(>!Ѐ=!p=!} D)EDG<@'˽#GC=@'˽#]% eJ! )ED}[@'˽# }e@'t˽#x=! *&"/f@'L˽#_ =$ e! A  ax=! =$ e! !&L"/f@'˽#+04 G=@'ʽ#8=% e)! (>"8^"P}@'ʽ# }3@'ʽ#x=! )&"/{f@'ʽ#_ =$ e! A /("G<@'Xʽ# 4x=! 1vH&h"/ef@',ʽ#=% e)! ?"`}@' ʽ#D   }@'ɽ#x=! )&"/Kf@'ɽ#_ =$ e! A  ^>^~@#k'ɽ##^>^^ F1^ RF08 > !DG_"G@'Hɽ##AI`HA @ ^ A@cD_ "CH$"D$0> 8^ "E ^ A[_q >["JX=$x! ABJX[ _$~=0@A0>8^G "@}@'Ƚ#) @?<_ =A^>^^@#k'pȽ##^> FGk<@'PȽ#=$ e! x=p!G_D   =$ e! h=!> !Dp}&@'ǽ# @  x=! )&"Ge@'ǽ#  ^> #k'ǽ##^> F)  }g@'|ǽ#x=! &")E/e@'Tǽ#=% e)! 0  }T@'0ǽ#x=! )&"Ge@'ǽ#_ =$ e! A^>#k'ƽ##^> 1F? >> !D ^"P}@'ƽ#DG >0U @ ")E/<@'|ƽ# À}џ@^>0#k'Tƽ##^>^~ F 1F RFx=`!?Z@G"_D  츀}EJE)E}@'Ž#@  + @?^>^~ 0#k'Ž##^>^~ ( F 1F RFG x`-?Z@E_"_D  츀}EJE)E}@'8Ž#@  + @? @A) A?^>^~ (0#kG/'Ľ##^>^~ (0޵8@^H~PX`ޜpG@'Ľ#P= Gk@'xĽ# Dv币=?P=E/:6@'DĽ# D p"e &"E/d@'Ľ#]p" &"E)E/d@'ý#E)EGGE@'ý# D E==$P! ]_P=$T! Ai)!DC +p+G6@'`ý# D@IJEGQ@'@ý# / +&"JE/d@'ý#) DC ? )鷴/ +&"Gd@'½#()?EE5@p>0 @p>E/ڃ@'½#ΥpGI@'½#\[pG @'d½#[=$H! AbJXG=&"1"p^B\G*d@',½#^>^~ (0ޥ8@^H~PX`ތ#k'##^>^~ (0޵8@^F 1FPXG=&X1"EGd@'#G)E C0@AD(cG=&j1"G.c@'P#EGn@'8#D =(}ޜ@'#"=&z1"ED/c@'#"EG#@'#@=!CC"D Er@E8}@'# =UB (}@'|#"=&1"E=&1"@}@'P# D =(}@'0#"=&z1"ED/c@' #EG@'#O 币=?P)O "@O "@ _p" &"Gc@'#) _p" )!I&"/c@'l#2jAJE?"EP}v@'H# kE)"!H5@@ o@U@@7 u@@c l)E@ DET@ D)(DC )JEEkE@ )JEEkE@ D_p" )!i& "EE/{c@'#EX}`@'p#kEX}[@'\#X>0 @X>8)EGX@'0# D)(DC )JEEkE]@ )JEEkE@ D_p" I&6"EEGHc@'#kEX}-@'#P>0 @P> )JEE}&ls":@ Dh}@()`?/"AAO R@ 2BBJE?"EP}@'0#Ep}϶@'#EG@'#G=&m1"X^P~Gb@'伽#^>^~ (0ޥ8@^`#k'##^>^~ F 1F+(%@ kEG@'p#W)(%@ &t"=&1"d_"x}@'<# GG0`@#A!(s @cA!(s A@ E@ #A!(%@ cA!(%@ 0`@ cD G#A!D!( "(%@0@A"D0`@#A"(?iJAlAGh@'#  A)!)E/+@'d# DG @._ / ac@!AA8A880`@ j@?pc@0AlA/m@'#)E^>^~ 0#k'캽##^>^~ (0G F 1FG4@'# D GU A +  D#C^ b@ B C@?cD> !DJEEG<@'P#KAC o? #8r? "8i? "8g? "8; +  D#C^ b@ B C@?cD> !DJEEG@'й#KA.? "8o? "8r? "8i? "8g? "8;=$0e! !) EGT@'p#!(EJE}c@'L# =(}@'0#"=&1"EJEDGa@'#"/@'# DE/@'ܸ# ]$0eB ")"E^>^~ (0@#k'##^>^~ (0޵ F 1F RF sFG"!*(sUd@d@"D cD!J!+Q`A)! )?@ E)E}@'#)9! )E)E}@'ܷ#JEkE@> !DH~"k@ @H^2PB?")EP}@'#KA .@)! )?@ E)E}@'h#)9! )JE^>^~ (0ޥP#k'$##^>^~ (0޵8G F 1FRF sF FJE/'@'Զ# D AkEG6@'#  A)! E#C^ b@ B C@?cD>! !E)E=&1"JEkE}R@'X#EEE)El_E^>^~ (0ޥ8@#kBGB 0(suD@ D@  s kG"B?Gk'##^>^~ G F=! G*@'x#G)E??"/@'\# D:` )E)E/׷@'<#kA @0@!  D#C^ b@ B C@?cD> !D kE*(!D % 3 F G@ I88)!8)!i8)!J!J(_!+A @ &"=&1"[_"x}@'x#;kE)EG@'X#E^>^~ 0#k'0##^G"1"0`@0(s@1(s A@?G`0( 1(  0( 1(G 0(1D0(%@ @0B0(%@ 0(  =&1"/ט@'|#@^#k'd##^>^ F 1FJERF/Ř@'4#=)E/d3@'#)EX}@'#JEX}@'첽#G^>^ #k'̲##^F==&L1"G3@'#^#k'##^>^~ F 1F=) GG4@'P# =) G/3@',# =kE > !D(~"G1@'#&JE(>Gq@'䱽#`JE(>i_=JE/2@'#&=kE/3@'# X}$@'#(X}@'l#kE_kEGՋ@'P# DJEGϋ@'8#=)EDG~2@'#= JE(^" > !DG1@'# JE/2@'԰#(X}@'# X}@'#JEG@'# DkEG@'#=)EDGP2@'`#^>^~0#k'@##^>^~ F 1F=) GGn3@'# =) G/e3@'ܯ# =JE/1@'# D @&"=&1"_"x}̖@'#} E/1@'t#E/X@'\# DJE/R@'D# )EDG2@'(#^>^~ 0#k'##^>^ F]* GG"3@'Ю# ]* G/3@'# ] )E > !D(~"G1@'# )E/82@'d# X}X@'P#(X}S@'<#)E_^>^0#k'##^>^ 1F=) G/2@'䭽# =JEG1@'#=JEG@'#= JE/@'# ^>^ #k'd##^>= G7@'<# G_0@'(#= G*@'# GR0@'#=G@'Ԭ#= G@'#^>#k'#0J5B$^~ F 1Fu`A 8=!G4 8=G+0@'# G >* >'8]* G/a2@'̫# 8=)E/0@'# D kE_ )EG_@'x#8=D > !D/ 1@'T#G^>^~0#k'0##^X}@'#G^#k'##^>8= =&T1"G/1@'̪# G/@'#^>#kG/G'##^>"G@'p# DGG22@'X# )E^>#k'4##^>H"/׉@'# D)EGH_"/I@'#? ))E^>#k'Щ##^> F X}.@'# X}(@'#0 X}"@'x#8 X}@'`#)EX}@'L#^>#k'4##^>^~ 1F RF*Gh/@'# D G )G.@'ب#0 0)G'@'#*I"@ l)E )E@)?G^>^~ 0#k'd## ^(>0^ F 1F )@> !DH~"Gk/@'(#JE)EP^"_P^@@ @"H>@ @)D_*! *x=! &"G]@'# H>@)@ Ge@'#@ @>)EG0@'p#*! *x=!* $)$ $ "}@'4#D}h@' #)IR }&* s"=$+ ! AD I&2 "=$? ! AD)>0)>8)>&I "G]@'# ^(>0^`#k'##^>^ F 1F G0@'h#?JE)E > !DG_ D8 ^@@)@"(( )(^"GG.@'# &s "=&| 1")_"}b@'襽#@) )G0@'ȥ#(X}1@'# (>@IG/@'#)E_x=! & "G4]@'h#^>^0#k'L##^>^~ (0G F 1F RF sF F@AA"D & "=&| 1"U_"} @'ऽ#0-  A`A"DG JEE/ވ@'#0 )EkEG׈@'#8 !A @ JE=& 1"_"ȃ}@'\# A`A"D +A X}Ρ@'(#)(%@ !A)EkE/@'# !A @ JE=& 1"_"ȃ}|@'У# A`A"Df +Ad  X}@'#)EkE/@'# !A @ JE=& 1"_"ȃ}\@'P#4 A`A"DF +AD )E)iA@/ !D0 A!  D#C^ b@ B C@?cD"F )EG@'Т#*)@;@GN@'#  ? -$ $-]B "@b ? (-_!A @N JE=& 1"_"ȃ}@'P#E=$ ! APO A`A"D +A GH)E)qAHO!0 A!  D$C~ @ c d@?D"F )E/k@'#*)@;H=& 1"PO"}@'#Po=$ ! AjYG`_ M=A _[Po KY[ _$Y`(M!A @ JE=& 1"_"ȃ}˶@' #? - E^>^~ (0`#k'̠##^>^~ (0޵8@^H~PXGR?R_R_D G _php_ G*( s"aI7A@ =AA@!=@k !=?EB@A@"0(D "1$AK@U$A @AD@䢵'A@@u'A @AD@䡕%A hO!á Au'A"D 'A =?EB@A@"0(D pO!"1$AK@U$A @AD@䢵'A@@u'A @AD@䡕%A [á Au'A"D G_J@Fá'A J!*( s!=?EB@A@"0(D{ Dá Au'A"D JE_Q3@/áU$A J!*( s_Q!k=?EB@A@"0(D- _Q G!`á Au'A"D =?EB@A@"0(D JE!R GáU$A JEJ!*( s!H Eáu'A J!*( s!??=?EB@A@"0(D?J!*( s3Eh/pOpEp@[k'# G(p% h/pO+Q@`/ !D0`A!  D#C^ b@ B C@?cD"F kEGL@'@#,+@;"=& 1"`OGZ@'# !!aA7 @)?aAE E_ӡ5aA }n@p @_p3AA"=& 1"_pGZ@'#GE^>^~ (0ޥ@^H~PX8#k'h#0(!@]"@!0